Protein Info for QEN71_RS27790 in Paraburkholderia sabiae LMG 24235

Annotation: Nif3-like dinuclear metal center hexameric protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR00486: dinuclear metal center protein, YbgI/SA1388 family" amino acids 5 to 246 (242 residues), 191.7 bits, see alignment E=8.7e-61 PF01784: DUF34_NIF3" amino acids 8 to 236 (229 residues), 203.3 bits, see alignment E=2.6e-64

Best Hits

Swiss-Prot: 63% identical to GCH1L_RALSO: GTP cyclohydrolase 1 type 2 homolog (RSc2931) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 95% identity to bph:Bphy_2744)

Predicted SEED Role

"FIG137478: Hypothetical protein YbgI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>QEN71_RS27790 Nif3-like dinuclear metal center hexameric protein (Paraburkholderia sabiae LMG 24235)
MDRIELELYLNNLLEISRFKDYCPNGLQVEGRRRIEKIATGVTASLAFLEAALEWGADAV
LVHHGYFWRNEAPQITGRKYHRLKALLANDLNLFAFHLPLDDHPLYGNNAQLGAKFGLIP
DGRFGDNDIGWMSTLPMPITLSHFTAEVEQTLGRTPLVLGDPDKNLRRVAWCTGGAQGYF
EAAIDAGADVYLTGEISEQVTHMSAESGVAFISAGHHATERYGVQALGTHLSEQFELEHL
FIDIHNPV