Protein Info for QEN71_RS27235 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome c biogenesis protein CcsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 24 to 24 (1 residues), see Phobius details transmembrane" amino acids 21 to 23 (3 residues), see Phobius details amino acids 41 to 53 (13 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 69 to 307 (239 residues), 92.3 bits, see alignment E=1.8e-30

Best Hits

KEGG orthology group: None (inferred from 96% identity to bph:Bphy_2642)

Predicted SEED Role

"FIG001154: CcsA-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>QEN71_RS27235 cytochrome c biogenesis protein CcsA (Paraburkholderia sabiae LMG 24235)
MDIVLYALTALLYGGLAVAGWRAHRQASAAPMLESVPPLPAAAPLPAGGRGLAGASAGMS
MTTRIVLLVALLAHGVLLHTTIFPHDAMVFGFAFALSAMFWLGAGIYWIESFFFPLDGLR
LLVLPLACIASLLPLVFNGVHVLSYAADPLFKLHFLIANIAYGLFVIAALHAVLMLLVER
RLHAMRGGALARQSAAAGNGWLSSWLDSLPPLLTLETLLFRLIGAGFVLLTLTLVSGILF
NEQLLDRALQLDHKTVFALLSWVMFGALLTARKVSGWRGRAALRWVLASFVALLLAYVGS
RFVFEVLLHRPVV