Protein Info for QEN71_RS27085 in Paraburkholderia sabiae LMG 24235

Annotation: L-arabinose ABC transporter permease AraH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 152 to 160 (9 residues), see Phobius details amino acids 173 to 202 (30 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 267 to 300 (34 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 326 (265 residues), 137 bits, see alignment E=3.4e-44

Best Hits

Swiss-Prot: 58% identical to ARAH_SHIFL: L-arabinose transport system permease protein AraH (araH) from Shigella flexneri

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 99% identity to bph:Bphy_2613)

MetaCyc: 58% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>QEN71_RS27085 L-arabinose ABC transporter permease AraH (Paraburkholderia sabiae LMG 24235)
MQARENLAQQAAKSAAEALIPQASDKQKWWQQITEYSLIVIFAVMFITMSLTVDHFFSIE
NMLGLALSISQIGMVACTMMFCLASRDFDLSVGSTVAFAGVLCAMVLNATGNTFIAIIAA
VVAGSVIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVSHGQAVGVSSDTFIALGGLS
MFGVSLPIWVTLVCFIVFGVMLNSTVYGRNTLAIGGNPEASRLAGINVERTRVYIFLIQG
AVTALAGVILASRITSGQPNAAEGFELNVISACVLGGVSLLGGRATISGVVIGVLIMGTV
ENVMNLMNIDAFYQYLVRGAILLAAVLLDQLKNRGTRD