Protein Info for QEN71_RS27005 in Paraburkholderia sabiae LMG 24235

Annotation: type I glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 3 to 106 (104 residues), 136.2 bits, E=4.4e-44
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 4 to 327 (324 residues), 431.1 bits, E=1.5e-133
• PF02800: Gp_dh_C
  • amino acids 160 to 315 (156 residues), 212.2 bits, E=3.1e-67

Best Hits

Swiss-Prot: 83% identical to G3PP_CUPNH: Glyceraldehyde-3-phosphate dehydrogenase, plasmid (cbbGP) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to bph:Bphy_2598)

MetaCyc: 58% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• Bifidobacterium shunt (15/15 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• gluconeogenesis III (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis IV (7/10 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Protein Sequence (336 amino acids)

>QEN71_RS27005 type I glyceraldehyde-3-phosphate dehydrogenase (Paraburkholderia sabiae LMG 24235)
MTIRVAINGYGRIGRNTLRAFYENGKKHDLEIVAINDLGDAKTNAHLTQYDTAHGKFPGE
VTVDGENLIVNGDKIRVLANRNPAELPWGELGVDVVMECTGFFTTKEKASAHIKGGAKKV
IISAPGGKDVDATIVYGVNHNVLKAEHTVISNASCTTNCLAPLVKPLNDKIGLETGLMTT
IHAYTNDQVLTDVYHEDLRRARSATHSQIPTKTGAASAVGLVLPELNGKLDGYAIRVPTI
NVSIVDLSFIAKRDTTVDEVNAIMKEASEGALKGILGYNSAPLVSIDFNHNPASSTFDAT
LTKVSGRLVKVSSWYDNEWGFSNRMLDTAVAFANAK