Protein Info for QEN71_RS26660 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 117 to 141 (25 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 224 (204 residues), 71.3 bits, see alignment E=7.8e-24 amino acids 232 to 414 (183 residues), 29.4 bits, see alignment E=4e-11 PF07690: MFS_1" amino acids 51 to 284 (234 residues), 67.7 bits, see alignment E=9e-23 amino acids 244 to 416 (173 residues), 59 bits, see alignment E=4.1e-20

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 96% identity to bph:Bphy_2529)

Predicted SEED Role

"Citrate-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>QEN71_RS26660 MFS transporter (Paraburkholderia sabiae LMG 24235)
MSSTIAASTAQRRSDTWRTVVAASIGNALEWFDLVVYGFFAVVISKLFFPAGNDTVSLLL
TLGTFGVSFFMRPLGAIVLGAYADRAGRKAALTLSILLMMAGTLIIAVLPTYQSIGLAAP
LILVVARLMQGFSAGGEFGSATAFLAEHVPGRRGYFASWQIASQGITTLLAAIFGAVLTS
QLSPEQLNTWGWRVPFFFGLLIGPVAWYIRTKLDETPEFLAAETTQTPIRDTFASQKTRL
FIGMGIVVLGTVATYLVLFMPTYAIKQLKLAPSVAFTAISLVGIIQLVFSPIIGHLSDRH
GRVRIMLVPAVLLFLLICPAFSYLVAHPTFGTLLAMQILLGILMTGYFGALPGLLSEIFP
VQTRTTGMSLAYNIAVTIFGGFGPFIIAWLIDATGSKIAPGFYLMLAAVVSVTALIAARR
KLGFR