Protein Info for QEN71_RS26525 in Paraburkholderia sabiae LMG 24235

Annotation: heat-inducible transcriptional repressor HrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF03444: HrcA_DNA-bdg" amino acids 2 to 73 (72 residues), 26.7 bits, see alignment E=3.7e-10 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 3 to 335 (333 residues), 310 bits, see alignment E=1.4e-96 PF01628: HrcA" amino acids 105 to 322 (218 residues), 220.6 bits, see alignment E=2.5e-69

Best Hits

Swiss-Prot: 100% identical to HRCA_PARP8: Heat-inducible transcription repressor HrcA (hrcA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 100% identity to bph:Bphy_2503)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>QEN71_RS26525 heat-inducible transcriptional repressor HrcA (Paraburkholderia sabiae LMG 24235)
MLDPRAQTLLKTLIERYIAEGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVISPHT
SAGRIPTPRGYRLFVDTMLTVEPSADEDAVMRAVKTTLQPGEPQKVVAAAASVLSNLSQF
AGVILTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRIMATQRDFTPSQLVEASNYI
NAHFAGLSFDEVRRRLREEIDELRGDMTTLMHAAVTASTDVTDTGETVLISGERNLLEVA
DLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFIGGESNLVPIEEMSVVTAPYEV
NGKIVGTLGVIGPTRMAYNRVIPIVDITARLLSMTLSQQ