Protein Info for QEN71_RS26490 in Paraburkholderia sabiae LMG 24235

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02349: chaperone protein DnaJ
  • amino acids 5 to 353 (349 residues), 454.9 bits, E=1.2e-140
• PF00226: DnaJ
  • amino acids 5 to 67 (63 residues), 98.3 bits, E=3.2e-32
• PF01556: DnaJ_C
  • amino acids 123 to 336 (214 residues), 179.3 bits, E=8e-57
• PF00684: DnaJ_CXXCXGXG
  • amino acids 150 to 210 (61 residues), 66 bits, E=4.3e-22

Best Hits

Swiss-Prot: 99% identical to DNAJ_PARP8: Chaperone protein DnaJ (dnaJ) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 99% identity to bph:Bphy_2496)

MetaCyc: 59% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Protein Sequence (377 amino acids)

>QEN71_RS26490 molecular chaperone DnaJ (Paraburkholderia sabiae LMG 24235)
MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEEHFKEGKEAYEMLSDS
QKRAAYDQYGHAGVDPNMAGAGAQGFGGFADAFGDIFGDIFGQAAAGGRGGRGGPQVYRG
ADLRYSMEITLEQAAHGYDTQIRVPSWVSCEICHGSGAKPGTKPETCPTCNGSGAVRMSQ
GFFSIQQTCPKCHGTGTYIPEPCTHCHGAGKTKETKTLEVKIPAGIDDGMRIRSAGNGEP
GINGGPSGDLYVEIHIKAHAVFERDGDDLHCQMPIPFTKAALGGEIEVPTLAGRASFTVP
EGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTDAQRDLLQQFEKSLVEGGAR
HSPQSKSWFDRVKSFFD