Protein Info for QEN71_RS26445 in Paraburkholderia sabiae LMG 24235

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 17 to 344 (328 residues), 463.3 bits, see alignment E=2.3e-143 PF00586: AIRS" amino acids 69 to 174 (106 residues), 87.7 bits, see alignment E=7.1e-29 PF02769: AIRS_C" amino acids 187 to 350 (164 residues), 134.5 bits, see alignment E=3.7e-43

Best Hits

Swiss-Prot: 97% identical to PUR5_PARP8: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 97% identity to bph:Bphy_2487)

MetaCyc: 60% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>QEN71_RS26445 phosphoribosylformylglycinamidine cyclo-ligase (Paraburkholderia sabiae LMG 24235)
MNQPKSAPNSPDSAQGLSYRDAGVDIDAGDALVDAIKPFAKKTLRDGVLGGIGGFGALFE
VPKKYKEPVLVSGTDGVGTKLRLAFQLNRHDTVGQDLVAMSVNDILVQGAEPLFFLDYFA
CGKLDVRTAATVVKGIAQGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVEKSKII
DGSKIMPGDVVLGLASSGIHSNGFSLVRKIIERAQPDLDADFDGRSLAEALMAPTHIYVK
PLLALMQQLEVKGMAHITGGGLVENIPRVLREGLTAELDHRAWPLPPLFAWLQKHGGVAD
AEMHRVFNCGIGMAVIVSAADAEAATGLLSAAGEQVWKIGTVRQSKEGEAQTVVV