Protein Info for QEN71_RS26310 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 42 to 387 (346 residues), 143.9 bits, see alignment E=3.2e-46

Best Hits

KEGG orthology group: None (inferred from 83% identity to bph:Bphy_2461)

Predicted SEED Role

"acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>QEN71_RS26310 acyltransferase (Paraburkholderia sabiae LMG 24235)
MSSTGTLTWLDRIGSRCVLRASASASGAPVAKLAAHDDARVAALDAGRALAIVGVILVHL
ALFMPALPAWLQAFADMGQYGVQLFFVISAVTIMLTLEEETKRFGDDRSLISRRFYVKRF
FRIAPLYYVAIAVYSLGNLLAAHFNTQITAPHDTADVLANLIFIHAWVPSAVNTVVPGGW
SIGVEVCFYLFAPLIFIATRTRRGLWRTSLALLVSSAFVLVAGACAGDVCIVENNSFLYY
WPPTQLPCFVVGFILARYGKRLLLRDGMKLSRFGIACALAACAGCLVLLYATGSGLGLAH
WLAPTLAACAAAALLLLLAQLPRRYPGARMVAAFGQNSYGLYIWSFVMILMVRVALKTPL
DALDHRVPVLGFAIAALFACCASYVAARISATRIERPCAQWARQVLLPRAAPAKRIEVSG
ETPE