Protein Info for QEN71_RS26075 in Paraburkholderia sabiae LMG 24235

Annotation: xanthine dehydrogenase accessory protein XdhC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR02964: xanthine dehydrogenase accessory protein XdhC" amino acids 23 to 173 (151 residues), 206.9 bits, see alignment E=1.8e-65 PF13478: XdhC_C" amino acids 30 to 172 (143 residues), 114.5 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_2420)

Predicted SEED Role

"XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>QEN71_RS26075 xanthine dehydrogenase accessory protein XdhC (Paraburkholderia sabiae LMG 24235)
MMHVPTFADMPVQVGRRSGHATKLPPPMHVVLFGAGHVGHALVSLLGRLPCVVQWVDERD
ELFPDEVPANVQVEATDTPDAIVDEAPAGTYFLVMTHNHALDFALAERIMRRRDFTYFGM
IGSKTKRVKFERRLIDRGVDPQRLFEMTCPIGVPGIVDKAPPSIAVAVCAELLQVRSQQI
SLADFASAQEADCVDV