Protein Info for QEN71_RS25990 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 135 to 147 (13 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details PF00672: HAMP" amino acids 183 to 231 (49 residues), 53.4 bits, see alignment 3.8e-18 PF00512: HisKA" amino acids 236 to 292 (57 residues), 29.7 bits, see alignment 8.2e-11 PF02518: HATPase_c" amino acids 338 to 442 (105 residues), 73.7 bits, see alignment E=2.4e-24

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 92% identity to bph:Bphy_2403)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>QEN71_RS25990 ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MSARALRYVLPRSVLGRNIALLIVLVAFSQVCALTVLIHYVQKPRVERAAAVFGTYIKTL
DNALTASPENARETLVARLDARSEPPAEAVSEPHVRVLAFYRTYQLVTFLETLHRYLPPG
TEVRWQGAPHPRMWIRMHVAATPYWIGLQVPEEAQGGGMLTAVLLSIGLGMLAALTGFAL
QAYLNRPLRELAHAARRVSAGETPPPLPVDGPTEIAQVSGAFNQMTQALQQAEATRALML
AGISHDIRTPLTKLRLAMAMANDTNGDETFVVAAESYLDTIDTILQQFMDYAGSGERETP
QRGDLNGLISQLAADFAGLGHEFDLQLGELPEHAFRPITMMRLVMNLMQNAVVYGQTGLS
VRTWADANAIVVAVGDRGKGLSAEELERLKAPFQRGKNAHGKTGGTGLGLAIVERIARLH
GGTLEFHAREGGGLEVWAVLPIRLDTHAAGTAPASGETSTAQPAL