Protein Info for QEN71_RS25860 in Paraburkholderia sabiae LMG 24235

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 111 to 111 (1 residues), see Phobius details amino acids 113 to 113 (1 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 347 to 361 (15 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 387 (328 residues), 138.4 bits, see alignment E=1.3e-44

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 94% identity to bph:Bphy_2339)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>QEN71_RS25860 sugar ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MTPDLTSSDSQGKHGTSLASGQRIKLLFARYKLLALLLAVAVIWVFFSFLTEGAFVTPRN
LSNLLRQMSITGMLACGMVFVIISGEIDLSVGSLLGLLGGVAAILDVTFHWPLAATLPVV
MLLGVIVGLFNGWWSTYLRVPSFIVGLGGMLAYRGVLLGITGGSTIAPVSDNLVFIGQGY
LPRIAGDTLAVVLFVLLAALTVRQRQKRQHYNLSVVPMWQDAVKIVASGLILLAFVATLN
RYGGIPVPVLLLLALLGIFTYIATQTVFGRRIYAVGSNLEATRLSGVNTNRVKLAIFALM
GLMCAFGGLINTARLAAGSPSAGSMGELDAIAACFIGGTSMRGGSGTVYGALIGALVMAS
LDNGMSMLDVDSYWQMIVKGGILVLAVWIDVISGSERR