Protein Info for QEN71_RS25445 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 304 (300 residues), 89.1 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: None (inferred from 88% identity to bph:Bphy_2281)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>QEN71_RS25445 acyltransferase (Paraburkholderia sabiae LMG 24235)
MTATTVVVHHVLIQDGQVFGQFRVDVFFVLSGFVIALALEASTISVRDFIVSRVVRIVPL
YWLATLLVFFGALLRPDLFNSTIASIPGLLKSLFFIPYRKPSGHVFPMLFVGWTLNYEML
FYAASALALWRFRRRLSLVLAAITLLLAGLFFVANLAHSDNAVVAVLAYDRMLEFPLGFA
VWYVWKKGVRIPVALAAPGAVGMYLLMTWLERAWPDISPLLGNGLPTCLLLMSTLSLEGL
VVDSALTRGLLYLGDASYAIYLSHPFVVEGMRKLVPKVAHGFDVRSPAGVTLAIVVASTF
GCAVYRYVDKPLQRALRRLINVKRLVNAPTNNEAPVR