Protein Info for QEN71_RS25430 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13477: Glyco_trans_4_2
  • amino acids 12 to 153 (142 residues), 60.7 bits, E=6.7e-20
• PF13579: Glyco_trans_4_4
  • amino acids 25 to 167 (143 residues), 46.2 bits, E=2.3e-15
• PF13439: Glyco_transf_4
  • amino acids 30 to 148 (119 residues), 36.1 bits, E=2.3e-12
• PF20706: GT4-conflict
  • amino acids 189 to 329 (141 residues), 26.6 bits, E=1e-09
• PF00534: Glycos_transf_1
  • amino acids 202 to 363 (162 residues), 93.3 bits, E=4.7e-30
• PF13692: Glyco_trans_1_4
  • amino acids 208 to 348 (141 residues), 95.4 bits, E=1.3e-30
• PF13524: Glyco_trans_1_2
  • amino acids 290 to 377 (88 residues), 39.5 bits, E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to bph:Bphy_2270)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (390 amino acids)

>QEN71_RS25430 glycosyltransferase family 4 protein (Paraburkholderia sabiae LMG 24235)
MKQSIESAGALRIALVCNTSFAIYQYRQGLIRELVARGVEVTVIAPRDRTTALLEQMGCR
FVELHVASKGTNPRDDLRTMLSLYRLYRSLRPHVVFHYTIKPNIYGTIAAKLAGVDSVAV
TTGLGYVFIQKSRAAQVAKLLYRFAFRFPREIWFLNQDDETAFRAQKLLAHPERARLLHG
EGVDLDQFAFTPMPDHQNGPENNQRAFSFVLIGRLLWDKGVGEYVEAARRLRATYPHARF
QLLGPVGVDNPSAISQAEVDAWVREGVIDYLGEAHDVRPLIAAADCVVLPSYREGVPRTL
MEASAMGRPIVATDVPGCREVVADGVNGLLCEARNVDSLAATLAQMLDMSDDERRAMAGR
GREKVAQEFDERVVVERYKSLIQQLTGISL