Protein Info for QEN71_RS25095 in Paraburkholderia sabiae LMG 24235

Annotation: cobyric acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF13500: AAA_26" amino acids 1 to 226 (226 residues), 65.9 bits, see alignment E=6.9e-22 TIGR00313: cobyric acid synthase CobQ" amino acids 1 to 478 (478 residues), 464.1 bits, see alignment E=2.8e-143 PF01656: CbiA" amino acids 1 to 227 (227 residues), 78.9 bits, see alignment E=4.9e-26 PF07685: GATase_3" amino acids 248 to 435 (188 residues), 193.3 bits, see alignment E=5.2e-61

Best Hits

Swiss-Prot: 95% identical to COBQ_PARP8: Cobyric acid synthase (cobQ) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 95% identity to bph:Bphy_2203)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>QEN71_RS25095 cobyric acid synthase (Paraburkholderia sabiae LMG 24235)
MIQGTTSDAGKSTLVAGLCRLARRAGVRVAPFKPQNMALNSAVTVDGGEIGRAQALQAVA
AGIDAHTDLNPVLLKPTSDRGAQVIIHGKARMNLDARAYHDYKPVAFEAVLESYARLKAS
YDAIFVEGAGSPAEINLRERDIANMGFAEAVDCPVVLVADIDRGGVFAHLTGTLACLSES
EQARVRGFVINRFRGDVSLLQPGLDWLEAKTGKPVLGVVPYLHGLTLDAEDMLPRELRAA
QASAEALRVVVPALPHISNHTDFDALRAHPQVDFHYVRSGTTPPPADLIILPGSKNVQGD
LAFLRAQGWDAVLQKHLRYGGRVIGICGGMQMLGREVADPYGVEGPPATVAGLGWLDFST
TLTREKTLKNVTGRLATSTADVAGYEIHMGETQGPALDAPALLLADEAGGVRPDGARSAD
NQILATYVHGLFDTPAACASLLEWAGLKNADAIDYPALREASLERLADTLAGHLDLKRLW
AAVG