Protein Info for QEN71_RS24950 in Paraburkholderia sabiae LMG 24235

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00212: hydroxymethylbilane synthase
  • amino acids 14 to 307 (294 residues), 340.9 bits, E=2.6e-106
• PF01379: Porphobil_deam
  • amino acids 14 to 220 (207 residues), 282 bits, E=2.6e-88
• PF03900: Porphobil_deamC
  • amino acids 234 to 306 (73 residues), 49.2 bits, E=5.8e-17

Best Hits

Swiss-Prot: 96% identical to HEM3_PARP8: Porphobilinogen deaminase (hemC) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 96% identity to bph:Bphy_2179)

MetaCyc: 58% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (31/36 steps found)
• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Protein Sequence (327 amino acids)

>QEN71_RS24950 hydroxymethylbilane synthase (Paraburkholderia sabiae LMG 24235)
MNSETLAPTPPATLVIASRESRLAMWQAEHVRCALHKLYPSCDVKILGMTTRGDQILDRT
LSKVGGKGLFVKELENALADGRADLAVHSLKDVPMELPEGFALSTIMEREDPRDAFVSNQ
YDSLAALPPGSVVGTSSLRREAMLRARYPELVVKPLRGNLDTRLGKLDRGDYAAIILAAA
GLKRLGLGDRIRSLLDPADSLPAAGQGALGIEIRADRADLAAWLAPLHHEHTAAAVEAER
MVSRALGGSCEVPLAAYATWHDGALHLRGVVATPDGQRVLSAQASSPAPTTGAALELGRD
VASQLEAQGALEIVRALSTASGPAASA