Protein Info for QEN71_RS24790 in Paraburkholderia sabiae LMG 24235

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF00072: Response_reg" amino acids 4 to 111 (108 residues), 84 bits, see alignment E=2.6e-27 PF00158: Sigma54_activat" amino acids 142 to 307 (166 residues), 233.8 bits, see alignment E=2.7e-73 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 62 bits, see alignment E=2.3e-20 PF01078: Mg_chelatase" amino acids 164 to 285 (122 residues), 21.5 bits, see alignment E=4.1e-08 PF07728: AAA_5" amino acids 165 to 290 (126 residues), 34 bits, see alignment E=8.4e-12 PF02954: HTH_8" amino acids 403 to 444 (42 residues), 49.5 bits, see alignment 8.4e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to bph:Bphy_2148)

Predicted SEED Role

"Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>QEN71_RS24790 sigma-54 dependent transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MPHVLIVDDDPSTREALAAIIAEDGLTTATAGDLREARIQLVRQMPDVVFTDLKLPDGTG
VDLFEDLDPRSGVEFVVITGHATVESAVSALKMGAADYLVKPINMQRVKSILARLPRAGD
LKAEIGTLRGELRRMGRFGLMLGNSGVMQQVYDQISRVAPTAASVMLVGESGTGKEVAAQ
TLHQLSLRRKHAFLAVNCGAISPNLIESEMFGHERGAFTGADRQHKGYFERANGGTLFLD
EITEMPIELQVKLLRVLETGMFMRVGTTKEIETDVRLIAATNRDPEQAVLEGKLRLDLYH
RLNVFPISLPPLRERGKDVELLAQSFLDELNEQHATKKHFPPAVREMLLSYPWPGNVREL
KNYVQRAHIMSGTDSDSTATVPLQISLSKPTAGTAITIPFGTSLAEADRQLILATLEQCG
GVKTRAAEILGISLKTLYNRLVEYGNDTGRDGDDVSDEPQALGKADA