Protein Info for QEN71_RS24680 in Paraburkholderia sabiae LMG 24235

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details PF02743: dCache_1" amino acids 56 to 281 (226 residues), 56.6 bits, see alignment E=4.2e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 337 to 493 (157 residues), 119.8 bits, see alignment E=4.9e-39 PF00990: GGDEF" amino acids 337 to 490 (154 residues), 132.9 bits, see alignment E=1.4e-42 PF00563: EAL" amino acids 511 to 746 (236 residues), 239.2 bits, see alignment E=6.3e-75

Best Hits

KEGG orthology group: None (inferred from 97% identity to bph:Bphy_2120)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (791 amino acids)

>QEN71_RS24680 EAL domain-containing protein (Paraburkholderia sabiae LMG 24235)
MNQFRLSSARDVRHRLDPAGTRRRALLAIPALGVLVLVLLWTVIFARLSVEKETTYREAM
ASAAILSAALEQHTVKAIHQVDQITRFVKFEFEKTPGRFDLASTVEKGVVQSETLVQVSL
IDEHGKLIANTAETNPKPIDLSDREHFKVHEHENDDQLFISKPVLGRVSGHWTLQMTRRL
NHPDGSFAGVVVVSEDPSYFTSDFYNNAAIGRDGVIAVISDSGSVLARRTGNSEHAQGVF
TATGVYPTSEHVSGTYVDSIDNVTRIVSYRHIDGYPLGVLVGLSQAEEFADYNHTRNVYL
LMASFISLAMLGFFAVATGLIGKLLGREREMTHLVEFDLLTGLRNRYSTLQSLRHEVAQP
ANVGRLAILFIDLDNFKTVNDTLGHNAGDIVLQMTAARLADAVADSGALSRIGGDEFVVV
IKGDDVEKRSVTLAEAIIEVFAKPFEVRGSSFVLHASIGIALYSVANESEIDLLKKADLA
MYSAKDAGKNCYQFYSPHLSHRADHLMKWEQQLRVALADQQLFLAYQPKIDLARRCITGF
EALVRWNHPQHGLIPANEFIPVAESTGLIVPIGDFVIRTACRQLAQWQQQGYDTLSLAVN
ISAVQFWRGDLYETISQAIEETGIAARRLELEITETAMMEYPDLVSEKIFALKRLGVRIA
LDDFGTGYSSLSYLNRFSVDTLKVDRSFVQAIPGDRSVCVMVTAIVNLARSLGLTVVVEG
TETEEQIAWLAALGHIEAQGFLFSRPVPADAIPALLERFGVCGMHGAHRAHGSDTDSTSD
AANTSTSNESA