Protein Info for QEN71_RS24660 in Paraburkholderia sabiae LMG 24235

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF00155: Aminotran_1_2" amino acids 54 to 390 (337 residues), 106.1 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 45% identical to ARAT1_THELN: Aromatic-amino-acid aminotransferase 1 (OCC_04335) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: None (inferred from 98% identity to bph:Bphy_2117)

Predicted SEED Role

"Valine--pyruvate aminotransferase (EC 2.6.1.66)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Pyruvate Alanine Serine Interconversions (EC 2.6.1.66)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.66

Use Curated BLAST to search for 2.6.1.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>QEN71_RS24660 PLP-dependent aminotransferase family protein (Paraburkholderia sabiae LMG 24235)
MNQSDLNAPTWQLSERARKLTSSAIREILKVTERPEVISFAGGLPSPATFPAEEMRAASD
RILRDSPAAALQYSATEGYLPLREWVAQRYSVNGAQIRASQVLITTGSQQALDLLGKVLV
CPESPVLVETPTYLGALQSFSMYEPHYVQVPTDDNGLIPEGLTPELTKGARLLYAQPNFQ
NPTGRRLPIERRRALAEFAKTAPFPVIEDDPYGALDYKGEPLPTMLSMAPDHIVHLGSFS
KVLAPGLRIGYIIAPEELHFKLVQAKQATDLHTPSFTQRIVHEVVKDGFLDTHVPKIRAL
YRDQCEAMLGSLERYMPEGVTWNRPEGGMFIWVSLPKHIDTMKLLEEAVAQNVAFVPGGP
FFANEAQHNTLRLSFVTVPPAKIDEGVARLAELIRARV