Protein Info for QEN71_RS24475 in Paraburkholderia sabiae LMG 24235

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF17773: UPF0176_N" amino acids 5 to 98 (94 residues), 85.1 bits, see alignment E=5.4e-28 PF00581: Rhodanese" amino acids 123 to 218 (96 residues), 29.4 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 81% identical to Y1152_PARXL: UPF0176 protein Bxeno_A1152 (Bxeno_A1152) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K07146, UPF0176 protein (inferred from 93% identity to bph:Bphy_2080)

Predicted SEED Role

"Rhodanese domain protein UPF0176, Betaproteobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>QEN71_RS24475 sulfurtransferase (Paraburkholderia sabiae LMG 24235)
MNILNLSAYQFSTLDNTVEWRPLVTARCNELGLRGTILLAPEGINLFVAGEIAQVREFIH
YVRHDPLFEGKFAELQFKESLSEKQPFRRMLVKLKREIITMKKPAIKPELGRAPSVDART
LKEWLDRGHDDAGRPVVMLDTRNAFEVDVGTFDNALDYRITRFSEFPEVIEQNRADLEGK
TVVSFCTGGIRCEKAAIHMKDVGIDNVYQLEGGILKYFEEVGGAHYNGECFVFDYRTALD
PSLQPTATVQCFGCRAVVTPEEQKSPFYVPGKTCASCHPEAQPQADAAHAA