Protein Info for QEN71_RS24260 in Paraburkholderia sabiae LMG 24235

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 36 to 295 (260 residues), 165.9 bits, see alignment E=1.4e-52 PF00532: Peripla_BP_1" amino acids 45 to 249 (205 residues), 36.3 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 62% identity to smd:Smed_4318)

Predicted SEED Role

"periplasmic binding protein/LacI transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>QEN71_RS24260 substrate-binding domain-containing protein (Paraburkholderia sabiae LMG 24235)
MNRNRRLITGALVTAPFAGLIVKAGYVHAQGKKYRFGFSQVTTVEPWRVQFNKDMKAEAA
KHPNVELVIADANDRTDKQNADMENFIAQKMDVIFISPKESAGLTGVVEKAYKAGIPVFV
LDREVNGDQYTQFVGGDNVLIGKGAGEFIVKTQGGAGKAKGNIVEVWGGFGTQASHDRHD
GMMSFVGKESGLKIVGQRVDCDWKQDKAYDYMKTVLRVNPQVDLVFAHNDPMAYGAYLAA
KDAGVEKKMKFVGADGLPNEGAVWVEKGILTATFVYPTPGGEAMRQALKMLGGEKIPKKV
IMPTQGIFADNAKQFVAS