Protein Info for QEN71_RS23690 in Paraburkholderia sabiae LMG 24235

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 135 to 151 (17 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF00892: EamA" amino acids 162 to 292 (131 residues), 56.5 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_1846)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>QEN71_RS23690 EamA family transporter (Paraburkholderia sabiae LMG 24235)
MKDSTLADPLTFDATPPAAPKRHVGVAALLGLMSMSCVQFGAALSAPTMDAFGAFSTTWL
RLAWAAVILAIVVRPKLRSYSRAHWLAAGVLGVAMAGMTLCFFSAIERIPLGLAVAIDFL
GPLTVATLGVRRLRALLWPLLAVAGVLLLARDRAGWIGDPVGMLLAAGAACGWGSYIVLM
KKTGALFNGLEGLSVSLIAAALVATPFGLTEHGVHIAPMQFAATAGLAVLVPLLPYALEM
IALRHMPAASFGILMSLEPAIGALAGFIVLHQPMTALQLAGTLFVVSASVGVIVTSR