Protein Info for QEN71_RS22945 in Paraburkholderia sabiae LMG 24235

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 223 (205 residues), 107.5 bits, see alignment E=1.5e-34 amino acids 218 to 391 (174 residues), 56.8 bits, see alignment E=3.8e-19 PF00083: Sugar_tr" amino acids 47 to 195 (149 residues), 88 bits, see alignment E=1.3e-28 amino acids 220 to 389 (170 residues), 46.1 bits, see alignment E=7e-16

Best Hits

KEGG orthology group: K08178, MFS transporter, SHS family, lactate transporter (inferred from 95% identity to bph:Bphy_1698)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>QEN71_RS22945 MFS transporter (Paraburkholderia sabiae LMG 24235)
MSWTREQRNVTIAAYLGWTLDAFDFFLMVFVLKDIASEFGTDIKSVSFAIMLTLMMRPVG
ALIFGFLADKFGRRPTLMINIACFSLLELLSGLSPNLTTLLILRALFGIAMGGEWGVGGA
LTMETVPPKARGFVSGLLQAGYPSGYLLAGLVFGQLYQYIGWRGMFFVGVLPALLVLYIR
AHVPESPAFKTLEKRTRPGLVTTLKKNVVLSVYAIVLMTAFNFFSHGSQDLYPTFLRIQH
NFDAHTVQWITITLNVGAIVGGLFFGALSEKIGRKRAICIAALIALPVLPLWAFSSTPVL
LAAGAFLMQISVQGAWGVIPVHLNEISPDEIRATFPGLVYQLGNLIASVNGPLQAGVAEA
HGNDYATVMAVVIGIVAVVIAVFIMFSRERRGIDMTRSAEQVAETATVH