Protein Info for QEN71_RS22905 in Paraburkholderia sabiae LMG 24235

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 12 to 223 (212 residues), 222.9 bits, E=1.7e-70
• PF06026: Rib_5-P_isom_A
  • amino acids 53 to 222 (170 residues), 199.3 bits, E=1.9e-63

Best Hits

Swiss-Prot: 87% identical to RPIA_PARP8: Ribose-5-phosphate isomerase A (rpiA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 87% identity to bph:Bphy_1693)

MetaCyc: 62% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• Bifidobacterium shunt (15/15 steps found)
• Rubisco shunt (10/10 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• oxygenic photosynthesis (12/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (231 amino acids)

>QEN71_RS22905 ribose-5-phosphate isomerase RpiA (Paraburkholderia sabiae LMG 24235)
MTQDELKQLVGRAAADYVIANVPEGAIIGVGTGSTANCFIDALASHKSRYRGAVSSSVAT
TARLQSHGIQVFDLNEIDSLQVYVDGADEIDASGAMIKGGGGALTREKIVASVSEKFVCI
ADATKRVDVLGQFPLPIEIVPMARTAIGRRVTALGGVPVLRVAKDGTPFITDNGNEILDV
KGLRISDPRTVEAHINAWPGVVTVGLFAARGADLCLLGTDKGVEKIEYARS