Protein Info for QEN71_RS22830 in Paraburkholderia sabiae LMG 24235

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 216 to 233 (18 residues), see Phobius details amino acids 254 to 270 (17 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 9 to 353 (345 residues), 95.3 bits, see alignment E=2e-31

Best Hits

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>QEN71_RS22830 acyltransferase (Paraburkholderia sabiae LMG 24235)
MATTNSRYDALDGLRGVAAIAVMMSHFTQEAFRNAYVAVDLFFMLSGFVIAHSYGARLLD
GMTAAEYVKRRVIRLYPMLLISLLIGLPVLIGAKALGLSTYPMQSIISATLHNLFFTPYI
GHFGNANMVAAGAVSAELTIGEIFPANPPAWSLFFEMVASIAFVIIVRLSRSTMFRISVV
GGLMFLITGALTSFEFHGHSVVDFSQGWSGGRLDGGFYRVIFGFVSGVLLYNLRSAGVDL
RIVDALKGVLRNSYGLYIVALIMFLFPMSLRGAYPAFVIFCVAPCLVMVGAKLPCASMFE
AKTAQFLGWLSYPVYLLHFPIGRAVFMLLGKHNESAAVPIAVACATTLVSAIIVTKYVDE
PIRAFLSKRLARSSAARARTVTPGGMADPNAG