Protein Info for QEN71_RS22455 in Paraburkholderia sabiae LMG 24235

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF08534: Redoxin" amino acids 5 to 139 (135 residues), 70.9 bits, see alignment E=1e-23 PF00578: AhpC-TSA" amino acids 5 to 131 (127 residues), 131.6 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 56% identical to BCP_XANCP: Peroxiredoxin Bcp (bcp) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 99% identity to bph:Bphy_0921)

MetaCyc: 38% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>QEN71_RS22455 peroxiredoxin (Paraburkholderia sabiae LMG 24235)
MPIAVDQPVPDFTAPATGGDFTLSSLRGKKVVVYFYPKDNTPGCTTEGLQFRDLYPKFKK
AGAEIIGVSRDSVRSHDNFKAKLELPFTLVSDPDETLCTLFGVMKLKKMYGKEVRGIERS
TFVIDAEGVLRREWRGVKVPGHVDEILEAVQAL