Protein Info for QEN71_RS22375 in Paraburkholderia sabiae LMG 24235

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 TIGR00738: Rrf2 family protein" amino acids 1 to 136 (136 residues), 108.7 bits, see alignment E=1e-35 PF02082: Rrf2" amino acids 3 to 137 (135 residues), 119.4 bits, see alignment E=2.5e-38 PF01978: TrmB" amino acids 8 to 67 (60 residues), 27.6 bits, see alignment E=4.2e-10 PF12802: MarR_2" amino acids 11 to 60 (50 residues), 28.3 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 47% identical to NSRR_GEOKA: HTH-type transcriptional regulator NsrR (nsrR) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 93% identity to bph:Bphy_0937)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>QEN71_RS22375 Rrf2 family transcriptional regulator (Paraburkholderia sabiae LMG 24235)
MRLTDYTDYSLRVLLYLAVRSEGLATIQDISDAYGISKNHLMKVVQRLAELGWVETVRGR
NGGLRLYEHSSALTVGEVVRAAESDFALVPCFNGVDASGAHRECVIQSQCRLKSVLESAR
DAFFRELDSYTIRDIAEPASPLMSLLGLKPSAVVVPIVPVASTGT