Protein Info for QEN71_RS22210 in Paraburkholderia sabiae LMG 24235

Annotation: peptidoglycan editing factor PgeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02578: Cu-oxidase_4" amino acids 27 to 275 (249 residues), 256.1 bits, see alignment E=1.5e-80 TIGR00726: YfiH family protein" amino acids 51 to 276 (226 residues), 184.2 bits, see alignment E=1.2e-58

Best Hits

KEGG orthology group: K05810, conserved hypothetical protein (inferred from 90% identity to bph:Bphy_0968)

Predicted SEED Role

"COG1496: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>QEN71_RS22210 peptidoglycan editing factor PgeF (Paraburkholderia sabiae LMG 24235)
MTLPELTFNDVLRPEWSVSPRVQALVTTRNGGVSLPPFGTWRDGVDGTGGLNLGRKSGDD
LAHVEANRARLMKLTGRDEAAWLSQVHGATVVNADDVLAAAKRGEPTTEADASVTDRTGT
VCVVMIADCMPVLLCDPQGRAVGAAHAGWRGLASGVVENTAQRVASLAGTDMSALHAYLG
PCIGPQTFEVGPDVRDAFMKSVGGAQRDEVAGAFVTHPTNAGKYLADLPQLARFRLAQIG
ITNVVGGDHCTVTERERFYSYRRDRETGRMAALIWLADH