Protein Info for QEN71_RS21985 in Paraburkholderia sabiae LMG 24235

Annotation: ATP-dependent Clp endopeptidase proteolytic subunit ClpP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 113 to 133 (21 residues), see Phobius details TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 27 to 217 (191 residues), 350.7 bits, see alignment E=1e-109 PF00574: CLP_protease" amino acids 38 to 217 (180 residues), 297.3 bits, see alignment E=2.2e-93

Best Hits

Swiss-Prot: 93% identical to CLPP2_PARXL: ATP-dependent Clp protease proteolytic subunit 2 (clpP2) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to bph:Bphy_1011)

MetaCyc: 68% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>QEN71_RS21985 ATP-dependent Clp endopeptidase proteolytic subunit ClpP (Paraburkholderia sabiae LMG 24235)
MTFRAQMLDTLTSQSSRDRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERVVFLVGE
VNDQTANLVIAQLLFLESENPDKDISFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGL
AASMGAFLLAAGAKGKRFALPNARVMIHQPLGGARGQASDIEIQAREILYLKERLNQLLS
HHTGQPVERIQRDTDRDNFMSGDDAQAYGLVDQVLHKRP