Protein Info for QEN71_RS21940 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00005: ABC_tran" amino acids 28 to 177 (150 residues), 117.8 bits, see alignment E=5.8e-38

Best Hits

Swiss-Prot: 48% identical to LOLD_ALKEH: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)

KEGG orthology group: K02003, (no description) (inferred from 98% identity to bph:Bphy_1018)

MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"putative ATP-binding component of a transport system"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>QEN71_RS21940 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MQKKTDPVIEVRGLCKRVKDATGELTILDNIDLSIHASSRVAIVGASGSGKSTLLGLLAG
LDSATSGSVRLLGRELTELDEDGRAALRNGSVGFVFQSFQLMPHLTALENVTLPLELQGG
LPARDVHARARTLLTQVGLGERMRHYPKLLSGGEQQRVALARAFATHPAILFADEPTGSL
DAATGHAVIDLMFEMNRANGATLVLVTHDVELARRCDTTVTIEAGRLI