Protein Info for QEN71_RS21815 in Paraburkholderia sabiae LMG 24235

Annotation: dTMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00041: dTMP kinase
  • amino acids 1 to 198 (198 residues), 170.7 bits, E=1.6e-54
• PF02223: Thymidylate_kin
  • amino acids 9 to 198 (190 residues), 156.9 bits, E=2.4e-50

Best Hits

Swiss-Prot: 96% identical to KTHY_PARP8: Thymidylate kinase (tmk) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 96% identity to bph:Bphy_1043)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Protein Sequence (206 amino acids)

>QEN71_RS21815 dTMP kinase (Paraburkholderia sabiae LMG 24235)
MARGKFITFEGIDGAGKTTHLGWFRDRLEQKVAGAGRSVVMTREPGGTKLGESLRDILLH
EAMDLETEALLMFAARREHLAQVIEPALARGDWVLSDRFTDATFAYQGGGRGLPRDKLET
LERWVQGGFQPDLTVLFDVPPDTASERRSAARAPDRFESESDAFFTRTRTEYLRRAEEAP
YRFAIIDSTRTIAEIQKQLEELIVSL