Protein Info for QEN71_RS21250 in Paraburkholderia sabiae LMG 24235

Annotation: AarF/UbiB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03109: ABC1
  • amino acids 94 to 339 (246 residues), 122.9 bits, E=6.4e-40

Best Hits

Swiss-Prot: 33% identical to UBIB_RALSO: Probable protein kinase UbiB (ubiB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_5062)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

Protein Sequence (518 amino acids)

>QEN71_RS21250 AarF/UbiB family protein (Paraburkholderia sabiae LMG 24235)
MPPLFRRLRLLFHALRYGARLIWLAAPEHHKLHWIVTLASRVHESPGGRAGVHRALPNLG
PLASAFAESLARRPELATGTLHDAIDAVSHLETPLPPDQVEHAIAAALGRPVSTLFAAID
LTPAKNGLAEQTHVARLIEPVNGHRDLAIKLIRAQQVQEIADEAALLRWVARWMEKLSKN
ARRLKLRELAETFTQEILRRFDLRAEAANLSQTAHHFDGDKRLAIPAVIWELCTDRTLAM
QHIESLPALDLGGLSARGVKLVPLAEHIIEVVTEQAFEHGFFHATLDARRVRVSIEPDTL
GRIVLADFAVMSSLSSQEREFFVHGATALFDQDYGRLAHLHRDAGHVSQDTRPEKLEAEL
RTRAEGHFAPESHERSAGALFHHLLFAVHPFGGAVPARLAAAQRAFGQAEMLANALHPGV
DSWKIARSVLATLARRERDHRGWVKHLAQELPHLAHLVPRIPQLAVRYLQHQHEVTHVRQ
QTQLVSDVLLEYRRTRTLLWACTVCGGLLGAIAVLLAY