Protein Info for QEN71_RS21185 in Paraburkholderia sabiae LMG 24235

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 207 (192 residues), 129.1 bits, see alignment E=7.7e-42

Best Hits

KEGG orthology group: None (inferred from 93% identity to bph:Bphy_5050)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>QEN71_RS21185 LysE family translocator (Paraburkholderia sabiae LMG 24235)
MISAHLLILYVTALVVVFALPGPDMALVLQTSIGRGARHGFAASLGLSISRAAHVTLSAC
GVAALLRNAPWLYEVVRYGGAIYLAWVAVQIFRSPVFALPSGSAPASDDGALRTAFVKGL
FTNLLNPKALLFCSVLLPQFVRPEAGPVAWQMIELGVVLVALGACFDAIYAIGAARIAGW
VRAHPLAQTLQRWTFSAALIGFAVRLSLD