Protein Info for QEN71_RS20770 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter transmembrane domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 10 to 583 (574 residues), 812.9 bits, see alignment E=8.5e-249 PF00664: ABC_membrane" amino acids 29 to 297 (269 residues), 179.8 bits, see alignment E=9.5e-57 PF00005: ABC_tran" amino acids 364 to 512 (149 residues), 116.5 bits, see alignment E=1.5e-37

Best Hits

KEGG orthology group: None (inferred from 87% identity to bgd:bgla_1g13970)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>QEN71_RS20770 ABC transporter transmembrane domain-containing protein (Paraburkholderia sabiae LMG 24235)
MPDAAARTRRVAPLSALLPFLRPYAKRWALAFLALLISASATLALPVAFKYLIDRGFASG
NRAHIDRYFIALFVLSLILAAATALRFYWVSWLGERVTADMRRAVYDHVMRMSPQFFETT
QTGEVLSRLTTDTTLIQTVVGTSLSLGLRNLLLTVGGVAMLIATSPVLSGYIIATLVVVV
APIVIFGRRVRRLSRASQDKVANASALAGEVLNAMPTVQSYTQESYESRRFDSAVEGAFA
TALTRIRARASLTAVVIVFVFAAIVFVLWLGAQAVLAGSMTAGQLSQFILYAVFTAGAVG
AVAEVWGDLQRAAGATERLLQLLAARSPVEDAQTTVPLPAHGDGIRFDNVGFSYPSRPGI
AALSAFSLDVRPGEHVALVGPSGAGKTTLFQLLLRFYDPQSGDISINGVSTNQVSLAALR
KAIGVVLQESVIFSGSVLDNIRYGMPDATFAQVQRAAEMAAAAGFIEALPQGYDTFLGER
GVRLSGGQRQRLAIARAILKDPPILLLDEATSALDAASERLVQTALDNAALNRTTLVIAH
RLATVQQADRIVVMDQGRIVAQGRHAELLHSSPLYAQLAALQFGELPGKAGEPDVLGDRV
DSH