Protein Info for QEN71_RS20210 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 304 to 305 (2 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 316 (265 residues), 102.7 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 98% identity to bph:Bphy_4656)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>QEN71_RS20210 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MKSSLSAGLFHDRQLNFLLAVNVLVVLLATWISHGQFVSIDNLQSMGGQLPELGLLALGI
MLSMVSGNGGIDLSGVGLANLSGMVAALIVPKFISGDDSPMLYTSVFCVIVVCMGAIGGF
INGVVIARLRLTPILCTLGTQLLFTGCAVVLSNGASVHVDYVEPLSDIGNGTWFQVPVAF
VIFIAAVVVLGWLLRRSPFGLRLYLMGTNPKAAFYTGIPRARMLILTYTMCGILASLAGL
ISVAHTSSAKWDYGNSYLLIAILIAVMGGVNPAGGYGRIVCVFFAATVLQFLSSFFNLLG
VSQFFGDCAWGFLLLASLAFAGGERVRAIFGFAQPNQRR