Protein Info for QEN71_RS20200 in Paraburkholderia sabiae LMG 24235
Annotation: RbsD/FucU family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 36% identical to FUCM_ACTP2: L-fucose mutarotase (fucU) from Actinobacillus pleuropneumoniae serotype 5b (strain L20)
KEGG orthology group: K02431, L-fucose mutarotase [EC: 5.1.3.-] (inferred from 96% identity to bph:Bphy_4654)Predicted SEED Role
"Fucose operon fucU protein"
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.1.3.-
Use Curated BLAST to search for 5.1.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (156 amino acids)
>QEN71_RS20200 RbsD/FucU family protein (Paraburkholderia sabiae LMG 24235) MLKNLDPLLNADVLHALRAMGHGDELVICDVNFPGDSVARESVTGKLLRLDGVDAPRAIR AVLSVLPLDTFVDDPALRMEVVGEPNTVPAVQREAQDEVNKAEGRDVPFVGIERFAFYAR AKKAYCVIATGEQRGYGCFVFKKGVLLAPDAPASKG