Protein Info for QEN71_RS19715 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 91 to 119 (29 residues), see Phobius details amino acids 162 to 198 (37 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 60 to 230 (171 residues), 83.6 bits, see alignment E=7.6e-28

Best Hits

Swiss-Prot: 64% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 83% identity to bgd:bgla_2g22520)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>QEN71_RS19715 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MTRRTVQLVGSLVAVVLVAVLLTRAIDASTWHQYSGDLVYYTGRHLSLVGISMTLAIVVG
IPAGVVLSRPALARQAESFMQIFNIGNTVPSLAVLAIALGIFGIGDIPAIIALFLASLLP
ITRNTYEGMKNVPASLLEAARGIGMTNMQSLTRVELPNAMPIVVGGVRTALAINVGTAPL
AYLIGADSLGTLIFPGIYLNNNQMLLLGAAGTAILALLLDAIVSAASRRWTTGSEVTP