Protein Info for QEN71_RS19715 in Paraburkholderia sabiae LMG 24235
Annotation: ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 83% identity to bgd:bgla_2g22520)Predicted SEED Role
"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (238 amino acids)
>QEN71_RS19715 ABC transporter permease (Paraburkholderia sabiae LMG 24235) MTRRTVQLVGSLVAVVLVAVLLTRAIDASTWHQYSGDLVYYTGRHLSLVGISMTLAIVVG IPAGVVLSRPALARQAESFMQIFNIGNTVPSLAVLAIALGIFGIGDIPAIIALFLASLLP ITRNTYEGMKNVPASLLEAARGIGMTNMQSLTRVELPNAMPIVVGGVRTALAINVGTAPL AYLIGADSLGTLIFPGIYLNNNQMLLLGAAGTAILALLLDAIVSAASRRWTTGSEVTP