Protein Info for QEN71_RS19710 in Paraburkholderia sabiae LMG 24235

Annotation: glycine betaine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04069: OpuAC
  • amino acids 28 to 295 (268 residues), 218.5 bits, E=6.3e-69

Best Hits

Swiss-Prot: 48% identical to OSMX_SALTY: Osmoprotectant-binding protein OsmX (osmX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05845, osmoprotectant transport system substrate-binding protein (inferred from 78% identity to bgd:bgla_2g22510)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Protein Sequence (300 amino acids)

>QEN71_RS19710 glycine betaine ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MKIIRFLKTALIAGALGVFASLPAMAAPLVLGGKNFTEQYVLIEITSQYLRSRGYTVDAR
TGLGSVLLRSAQENGQVDVTWEYTGTAALVYHKLKEKLSPDAMYQRVKDLDAKQGLVWLN
KSPLNNTYALGLPAEAAQKSGIRTISQLADKMKSDPKGTRHVFGMDAEFANRPDGLKPLE
ATYDLHFSRAETKQMDPGLVYTALHNNQLTIGLVYTTDGRVKGFGIVPLEDDRHFFPPYN
ATPVVRASVLQQNPKLAEQLNALSGALNNDTMLEMNKQVDIDGKSVQAVASEFLRTHKLP