Protein Info for QEN71_RS19270 in Paraburkholderia sabiae LMG 24235

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF12146: Hydrolase_4" amino acids 21 to 237 (217 residues), 64.4 bits, see alignment E=4e-21 PF00561: Abhydrolase_1" amino acids 21 to 131 (111 residues), 86.4 bits, see alignment E=1e-27 PF12697: Abhydrolase_6" amino acids 22 to 249 (228 residues), 92.7 bits, see alignment E=2.1e-29 PF00975: Thioesterase" amino acids 22 to 251 (230 residues), 35.5 bits, see alignment E=4.8e-12 PF03096: Ndr" amino acids 68 to 254 (187 residues), 25 bits, see alignment E=3e-09 PF14534: DUF4440" amino acids 273 to 378 (106 residues), 31.1 bits, see alignment E=1.2e-10 PF13474: SnoaL_3" amino acids 273 to 378 (106 residues), 22.2 bits, see alignment E=6.1e-08 PF12680: SnoaL_2" amino acids 275 to 374 (100 residues), 38 bits, see alignment E=8.9e-13

Best Hits

KEGG orthology group: None (inferred from 81% identity to bxe:Bxe_B2696)

Predicted SEED Role

"N-formylglutamate deformylase (EC 3.5.1.68)" in subsystem Histidine Degradation (EC 3.5.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.68

Use Curated BLAST to search for 3.5.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>QEN71_RS19270 alpha/beta fold hydrolase (Paraburkholderia sabiae LMG 24235)
MDIETNGTRIHVSQLGSGELALVFLHYYGGSSRTWDKVAKALPDRYRIVATDHRGWGDSA
APAHGYRIEDLANDAEGVIEALGLKRFVLVGHSMGGKVAQLMASRRPKGLEGLVLVAPSP
PSPMLLSDEERATLSRAYQSRESVEFVIDRVLTARPLDAACREQVIEDSLKAAPQAKAAW
PEVAMREDISVAVASIVVPTIVVSGEQDQVDRVATLQAELLPRIPHAAMHILPGTGHLSP
LEAPVEVAQNIARFVAAIEDKSVVCNSPADVPAAFDAAMNAGDLDALLRVFSNNATMRMT
NGDVAQESPGDLRRSLAHLLAMRPHIRNTVRRVLSSGEIALVLLDWTLSIPRPDGQKHVE
QGAAAQVLEKGRDGGWRLRISNPLGLN