Protein Info for QEN71_RS19055 in Paraburkholderia sabiae LMG 24235

Annotation: Na/Pi cotransporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 14 to 148 (135 residues), 124.2 bits, see alignment E=4e-40 amino acids 161 to 245 (85 residues), 35.1 bits, see alignment E=1.3e-12 PF01895: PhoU" amino acids 343 to 419 (77 residues), 28.4 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 86% identity to bph:Bphy_4758)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>QEN71_RS19055 Na/Pi cotransporter family protein (Paraburkholderia sabiae LMG 24235)
MSLTLLDLAGSVALLLWGTHMVQSGIQRVFGAGLRTLLGRALHGRFCAFLAGLGITAILQ
SSTATGLMTAGLVAAGLVETVPALAVMLGANVGTTLIVQALSFDVSAASPALILVGVLMF
RKAANTRTHDLGRTLIGLGLMLLALHQLLRLMMDQDDVSILSTQLHAASSAPLLNVLVAA
GLTWATHSSVAVVLFIMSLCAQNVVPPDAAFALVLGANLGTAINPVLEGTQSTDPAAKRL
AIGNLLSRATGVVIAMAALDPIGRAMVTIEPDNARVVADFHTLFNLIVAGLFMLVLSPYA
ALLARLLPQQERSADPGQPLYLDPMSRQFPVVALANAAREALRLADVLGDMLAGARAVLS
NGDRRLVTETRQRDDILDSLNAAIKTYLTSLDPEQLTDDDRQRLNEILTFVVNIEQAGDV
VDLNLLPHATKRVKRRLAFSKEGEAELLDMLDRLTVNLRTAASLLMTQDARIARTLADEK
VTFRAAESAATAAHFERLRSGRLDTAQTSAMHLDLLCDMKLINSHIVAAAAYPILERDGV
LLVSRIAANDSYPSLDKDLSTGESSSRLPLQSR