Protein Info for QEN71_RS18900 in Paraburkholderia sabiae LMG 24235

Annotation: cytochrome c oxidase assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 53 to 71 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF09678: Caa3_CtaG" amino acids 64 to 308 (245 residues), 209.4 bits, see alignment E=2.7e-66

Best Hits

KEGG orthology group: None (inferred from 86% identity to bph:Bphy_4795)

Predicted SEED Role

"FIG00457288: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>QEN71_RS18900 cytochrome c oxidase assembly protein (Paraburkholderia sabiae LMG 24235)
MVAVALSMKRSIRHLRGRVAFMAALTLAPGVACAHGLTGSVESPPSFGWTYEPWVVALMA
VSIAAYVTGYWRLRNRASLRSHSARVRATHLIGFLSGWVALALALFSPLDTLSGALFSAH
MVQHESMMLIAAPLLVAGRPLGVWMWALPRRARAGVGRCVRADGFSSCWRGLTTPLTAWL
LHAVALWAWHMPTMFQAALLHPWIHSLQHASFLLTALLFWWTVAGEGARRQTGGHAMLSL
FTTMVHTGALGALITLAPGLWYPLYAEPCSAMGVDPLHDQQLGGLIMWVPAAAAYLIGAL
AIAARWLTRRKAPALATGQAVIVPRDGST