Protein Info for QEN71_RS18240 in Paraburkholderia sabiae LMG 24235

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 36 to 206 (171 residues), 85.3 bits, see alignment E=1.9e-28 PF04542: Sigma70_r2" amino acids 40 to 108 (69 residues), 46.8 bits, see alignment E=4.1e-16 PF08281: Sigma70_r4_2" amino acids 151 to 200 (50 residues), 44.7 bits, see alignment 1.7e-15 PF04545: Sigma70_r4" amino acids 156 to 203 (48 residues), 37.6 bits, see alignment 2.5e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 73% identity to bge:BC1002_6148)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>QEN71_RS18240 RNA polymerase sigma factor (Paraburkholderia sabiae LMG 24235)
MKRETMDATLADASTTPRPDDDLEIAHRIAAGDRAAFELLMRRHNRRLYRLARATLRNDA
EAEDALQDAYLNAYRSIAQFRGDAKLFTWLSRLVLNECFARMRREARRQNVVPILHDCPD
DEQMSSTMHTTNAHDYNAPDQAAARAEIRALLERKLDALPAGFRTVFVLRSVEEMSVEET
AQCLDIPEATVRSRHFRAKLLLRDALADEVDTLGPDLFEFGGAHCDHIVASVLARLRGT