Protein Info for QEN71_RS17810 in Paraburkholderia sabiae LMG 24235

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12849: PBP_like_2" amino acids 27 to 244 (218 residues), 31.8 bits, see alignment E=3.2e-11 PF13531: SBP_bac_11" amino acids 33 to 256 (224 residues), 191 bits, see alignment E=6.9e-60 PF01547: SBP_bac_1" amino acids 38 to 248 (211 residues), 87.1 bits, see alignment E=5.6e-28 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 38 to 254 (217 residues), 196.9 bits, see alignment E=2.1e-62 PF12974: Phosphonate-bd" amino acids 107 to 217 (111 residues), 28.9 bits, see alignment E=2e-10 PF13343: SBP_bac_6" amino acids 161 to 258 (98 residues), 31.5 bits, see alignment E=3.1e-11

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 95% identity to bph:Bphy_4405)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>QEN71_RS17810 molybdate ABC transporter substrate-binding protein (Paraburkholderia sabiae LMG 24235)
MSLPSMIRFLKPALLVASAISFAFSAQARADELVVSAAASLTNAFKAVGDAYEKEHPGTR
LLFNFGASDVLMQQIVKGAPADVFASADQKAMDKAAEQKVIVPSTRKDFAANSLVLIVPT
DSKLAPSNLNELTSASVKRIAYGDPASVPVGRYTEGALKAAGVWDAVSAKGVLASNVRQS
LDYVSRGEVDAGFVFGTDAAVMPDKVKVALTVPTTTPISYPIAQVEGSKHAADAQSFITF
VLSPAGQAVLAKYGFKPAH