Protein Info for QEN71_RS17680 in Paraburkholderia sabiae LMG 24235

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 467 (466 residues), 506.3 bits, see alignment E=5.2e-156 PF13522: GATase_6" amino acids 64 to 197 (134 residues), 50.1 bits, see alignment E=4.5e-17 PF13537: GATase_7" amino acids 81 to 214 (134 residues), 48.5 bits, see alignment E=1.2e-16 PF00156: Pribosyltran" amino acids 281 to 396 (116 residues), 39.8 bits, see alignment E=4.4e-14

Best Hits

Swiss-Prot: 59% identical to PUR1_PASMU: Amidophosphoribosyltransferase (purF) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 98% identity to bph:Bphy_4381)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>QEN71_RS17680 amidophosphoribosyltransferase (Paraburkholderia sabiae LMG 24235)
MCGIVGVVSQSPVNQLLYDSLLLLQHRGQDAAGIATANGSTFHMHKANGMVRDVFRTRNM
RSLPGTSGIGQVRYPTAGSASSEEEAQPFYVNAPFGIILAHNGNLTNWQQLKDEMFRVDR
RHINTNSDTEVMLNVLAHEVQTASSGLQLDPAAMFKAVSGVHRRVRGSYAIVSLISGYGL
LGFRDPFGIRPLCIGKLETASGTEWMLASESVAIEGIGFEFVRDVAPGEAIFIDFEGNFH
AQQCAPNASLNPCIFELVYLARPDSVLDGVPVYNARLRMGDYLAEKILRELPKDVKIDVV
MPIPDSSRPAAMQVAAKLGVEYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMGIEFK
GKNVLIVDDSIVRGTTSHEIVQMARDAGASKVIFASAAPPVKFPNVYGIDMPTRSELVAH
DRSDEEVARLIGADFLVYQDVDALKNAVRDINPALKEFEASCFDGNYITGDVTSEYLDRI
ESARLAPSAQSDRDAASEAIDGGAARSQLHLQLSVE