Protein Info for QEN71_RS17360 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 24 to 166 (143 residues), 126.6 bits, see alignment E=1.1e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 39 to 333 (295 residues), 362 bits, see alignment E=1.4e-112 PF08402: TOBE_2" amino acids 284 to 362 (79 residues), 55.7 bits, see alignment E=4.5e-19

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 97% identity to bph:Bphy_4321)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>QEN71_RS17360 ABC transporter ATP-binding protein (Paraburkholderia sabiae LMG 24235)
MKTEDVIVSFRGVRKTYDGETLVVKQLDLDIYQGEFLTLLGPSGSGKTTCLMMLAGFEFP
TGGEIWLDDQLLNNVPPHKRNIGMVFQNYALFPHLTVEQNVAYPLTVRKLPADERAHKVN
NALKMVRMEGFAKRYPAQLSGGQQQRIALARALVFEPKLVLMDEPLGALDKQLREHMQYE
LKSLHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDTVDSLYESPCNEFVANFIG
DSNRLRGTVANVDGDYCEFHLIDGTRLVGRNIGGAQAGAEGIACIRPERMKLAAGASKPG
ANALAGEARGLIYFGDHVRMRCGLPQQDECFVKVPLGTEVLNGFAPGVPVALEFAPEHLR
VFA