Protein Info for QEN71_RS16850 in Paraburkholderia sabiae LMG 24235

Annotation: glutathione ABC transporter permease GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details PF12911: OppC_N" amino acids 22 to 75 (54 residues), 53.8 bits, see alignment E=1.4e-18 PF00528: BPD_transp_1" amino acids 116 to 299 (184 residues), 118.7 bits, see alignment E=2.6e-38

Best Hits

Swiss-Prot: 77% identical to GSID_PECAS: Glutathione transport system permease protein GsiD (gsiD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 95% identity to bph:Bphy_4223)

MetaCyc: 77% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>QEN71_RS16850 glutathione ABC transporter permease GsiD (Paraburkholderia sabiae LMG 24235)
MSTTADNTRTVSSAHEERAIRTPWSEFWRKFRKQHVALAAGVFVLLLIVVSIAGPHIVPF
DPENYFDYDALNAGPSAAHWFGVDSLGRDIFSRIVAGTRISLAAGFFSVAIGAIIGTLFG
LLAGYYEGWWDRITMRVADVLFAFPGILLAIGIVAILGNGMINVIAAVAVFSIPAFARLV
RGNTLMLKQLTYIEAARSIGASDWTIIMRHILPGTISSVIVYLTMRIGTSIITAASLSFL
GLGAQPPTPEWGAMLNEARADMVTAPHIALFPSLAIFLTVLAFNLLGDGLRDALDPKLDR
P