Protein Info for QEN71_RS16375 in Paraburkholderia sabiae LMG 24235

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03466: hopanoid-associated sugar epimerase" amino acids 9 to 334 (326 residues), 511.4 bits, see alignment E=4e-158 PF02719: Polysacc_synt_2" amino acids 9 to 119 (111 residues), 30.7 bits, see alignment E=7.6e-11 PF01370: Epimerase" amino acids 9 to 236 (228 residues), 114.7 bits, see alignment E=1.9e-36 PF05368: NmrA" amino acids 9 to 122 (114 residues), 44 bits, see alignment E=7.6e-15 PF01073: 3Beta_HSD" amino acids 10 to 224 (215 residues), 68.2 bits, see alignment E=2.6e-22 PF16363: GDP_Man_Dehyd" amino acids 10 to 254 (245 residues), 47.9 bits, see alignment E=5.4e-16 PF13460: NAD_binding_10" amino acids 13 to 176 (164 residues), 58.6 bits, see alignment E=3e-19 PF07993: NAD_binding_4" amino acids 64 to 184 (121 residues), 37.6 bits, see alignment E=5.6e-13

Best Hits

KEGG orthology group: K00091, dihydroflavonol-4-reductase [EC: 1.1.1.219] (inferred from 96% identity to bph:Bphy_4126)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>QEN71_RS16375 NAD-dependent epimerase/dehydratase family protein (Paraburkholderia sabiae LMG 24235)
MTDQTRDLVLVTGASGFVGSAVARIAQQKGFAVRVLVRPTSPRRNVESLDAEIAVGDMRD
EASMRAAMRGARYLLHVAADYRLWAPDPHEIERANLEGTEATMRAALKEGVERVVYTSSV
ATLKVTGSGASVDETSPMTPDQAIGVYKRSKVLAERAVERMIANDGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAMGHFLALERGKIGERYILGGENL
PLQQMLADIAGMVSRKPPTIALPRWPLYPLAVGAEAVAKFTKREPFVTVDGLKMSKNKMY
FTSAKAERELGYQARPYREGLRDALDWFREAGYLKA