Protein Info for QEN71_RS16265 in Paraburkholderia sabiae LMG 24235

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 122 to 366 (245 residues), 80 bits, see alignment E=4.9e-26 PF00535: Glycos_transf_2" amino acids 125 to 304 (180 residues), 68.9 bits, see alignment E=1.1e-22 PF13506: Glyco_transf_21" amino acids 202 to 364 (163 residues), 31.7 bits, see alignment E=2.1e-11 PF13632: Glyco_trans_2_3" amino acids 218 to 417 (200 residues), 75.2 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 91% identity to bph:Bphy_4104)

Predicted SEED Role

"Glycosyltransferases, probably involved in cell wall biogenesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>QEN71_RS16265 glycosyltransferase (Paraburkholderia sabiae LMG 24235)
MDIDVIDEDVTLINPALAGEPSNAAGSRPKLSLREALAAASPRINPRKGTWQSAVIHGSV
TALWLLLFARAFFLHGALAWSTGIAYVLYDTLLLAFVTVKTLPLIRRSLPAHRSADAADL
PSMGVIVAAHNEAGVLPVTLAALLRQTHGPAQIVIADDGSTDGTRDLLTRRFGLVEPVPG
ELSAPSSRYPNLYWLRVPHGGKAPALNAAIEVMTTETVMTVDADTLLADDATLAMRAAFA
QSPKLVAATGILVPVCDRTASGRVFQWFQTYEYMRNFIARFAWMRADSLLLVSGAFASFQ
RKALVAVGGFDGQCLVEDYELIHRLRRYSVDRDLGWEVRVVGDAHAQTEAPATLGAFLRQ
RRRWFAGFLQTQYWNRDMTGNARYGTLGRLMLPVKAFDTMQPIYGLTAFALLLGFVFGGH
GTIVVSIFSVIGLKTAIDLAFYVWSIHLYRRWTGLTRGTSLPMAVAAAIAEPFTFQLLRH
TGAALGWLQFLRGGKTWGKQHRAGLVGATQATR