Protein Info for QEN71_RS15820 in Paraburkholderia sabiae LMG 24235

Annotation: Fe(3+)-hydroxamate ABC transporter permease FhuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 252 to 280 (29 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 372 to 397 (26 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details amino acids 512 to 535 (24 residues), see Phobius details amino acids 561 to 580 (20 residues), see Phobius details amino acids 604 to 635 (32 residues), see Phobius details amino acids 647 to 668 (22 residues), see Phobius details amino acids 674 to 694 (21 residues), see Phobius details PF01032: FecCD" amino acids 49 to 345 (297 residues), 193.6 bits, see alignment E=2.3e-61 amino acids 389 to 693 (305 residues), 264.4 bits, see alignment E=6.1e-83

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 89% identity to bph:Bphy_4043)

Predicted SEED Role

"Ferrichrome transport system permease protein FhuB (TC 3.A.1.14.3)" in subsystem Iron acquisition in Vibrio (TC 3.A.1.14.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (704 amino acids)

>QEN71_RS15820 Fe(3+)-hydroxamate ABC transporter permease FhuB (Paraburkholderia sabiae LMG 24235)
MTTLAARKRMQRAAPRWRDVQQSRVGMLTISLTVMLVVIAALRLAPDLSMLLHAATSNAG
HTSDENALAHVLLVNLHVPRVLAAIVAGACLGVAGALFQALTRNPLASPDLLGITGGAQL
GLLAAMLIPALAGTASVPLLFACGLLAAACVAAAAGGWRATPLRMVLAGSVCMLLFSAVS
TLTLAFFEQSIAGVALWASGSLYQPGADGLLTAVLWLLLPLAALPFVVRPLDPIALGDDA
ALAVGVRVDAARFYALLVAVGFASVAVSIAGPMSYVGLIAPNLLRHLRGSRSTRLAALAP
LSALVGALLVLATDSMVLALDLDGTLSTGVAIAVVGTPLMLAMIRHGGAWTSALTNTADA
AAQTARGRFASWITGLSAFGIASMVVAVVVVSIYAAGTLGSTTLDPSRWLAALNGNDAVA
RMLLDLRLPRVACALLAGAMLAASGVLMQSVVRNPLAGPEVVGVTQGASLATLVALLFWP
LAAHATIAVSSLIGGGITLVAILALNRRTRYAPLAVALTGLVVGTLWTTLAQWVIVQESV
QPARFVVWLVGGTYGRSWSDVLALLPWCALALPAFVLLARPLDLLALGDDQAASLGLPVA
LLRPLALTVATVAACAAVAAVGPIGFVGLMAPHLAAMLGARAHRMRLWLAATCGAAILAA
ADIGARTLLAPREIPAGVLTALIGAPYLLALLIVQARRERKRGR