Protein Info for QEN71_RS15580 in Paraburkholderia sabiae LMG 24235

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 28 to 124 (97 residues), 34.3 bits, see alignment E=2.3e-12 PF00528: BPD_transp_1" amino acids 135 to 356 (222 residues), 139.7 bits, see alignment E=9.1e-45

Best Hits

Swiss-Prot: 44% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 97% identity to bph:Bphy_4005)

MetaCyc: 42% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>QEN71_RS15580 ABC transporter permease (Paraburkholderia sabiae LMG 24235)
MSTTLTPIDRIRAASTRSAGVRWTLRVLRWVLTLAITFTGLLAVTFVIGRKVPIDPVLAI
LGDRASASAYAAARIQLGLDKPLVEQFFIYVSAVLHGDLGVSLLTANPVIDDIKRVFPAT
LELATLATIIGVLVGVPLGVIAATRHNRWIDHVARFIGLIGSSVPVFWLGLMGLLLFYAK
LHWVSGPGRLDPVFDGMVDTHTGSLLIDSLIAGEWDVFFNALSHIALPAAILGYYSVAYL
SRMTRSFMLDQLNQEYITTARAKGLSERRVVWVHAFGNIAVPLLTVIALSYSFLLEGSVL
TEIVFAWPGIGSYLTGALLNADMNAVLGSTLVIGMTFIALNLLTDALYRVFDPRAR